PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC12713_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family HB-other
Protein Properties Length: 118aa    MW: 14145.6 Da    PI: 6.8005
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC12713_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.1e-2063118156
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  +++ +++t+ q++eLe++F+++++p+ ++r+eL++ lgL+  q+k+WFqN+R+++k
  RrC12713_p1  63 KKRYHRHTQRQIQELESFFKECPHPDDKQRKELSRDLGLEPLQIKFWFQNKRTQMK 118
                  688999***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-2542118IPR009057Homeodomain-like
SuperFamilySSF466891.45E-1949118IPR009057Homeodomain-like
PROSITE profilePS5007117.03860118IPR001356Homeobox domain
SMARTSM003897.5E-1261118IPR001356Homeobox domain
CDDcd000863.67E-1663118No hitNo description
PfamPF000462.6E-1863118IPR001356Homeobox domain
PRINTSPR000314.3E-591100IPR000047Helix-turn-helix motif
PROSITE patternPS00027095118IPR017970Homeobox, conserved site
PRINTSPR000314.3E-5100116IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MYHPNMFEGH HMFDMTTKST SDNDFGITGS REDDFETKSG TEVTNENPSG EELQDPNQRP  60
NKKKRYHRHT QRQIQELESF FKECPHPDDK QRKELSRDLG LEPLQIKFWF QNKRTQMK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3528681e-149AK352868.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-14-J22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629801.14e-80PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2
RefseqXP_013629800.14e-80PREDICTED: homeobox-leucine zipper protein PROTODERMAL FACTOR 2
SwissprotQ93V993e-78PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A0D3B8G44e-80A0A0D3B8G4_BRAOL; Uncharacterized protein
STRINGBra000807.1-P2e-79(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.12e-79protodermal factor 2